SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|386011704|ref|YP_005929981.1| from Pseudomonas putida BIRD-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386011704|ref|YP_005929981.1|
Domain Number 1 Region: 87-223
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.67e-23
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 15-85
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.42e-18
Family GntR-like transcriptional regulators 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386011704|ref|YP_005929981.1|
Sequence length 250
Comment GntR family transcriptional regulator [Pseudomonas putida BIRD-1]
Sequence
MKRQPLDDSFKVNRNPVTLREIVLDKLRTAIMNFHLLPGDRLVERDLCDRLGVSRTSVRE
ALRHLESEGLVEFADAKGPRVAIITLEDARDIYELRCVLEGLIVQLFTLNAKAKDIRALE
RALEVNREALEEGELQQVLDSVQGFYDVLLEGSGNQVAAQQLRQLQARISYLRATSVSQE
NRRGASNREMEKIVEAIKGGDPLVAHQASVDHVRAAAKVALDYLRQKQDDNAKVRDIVEP
LALKEPRIGR
Download sequence
Identical sequences A0A0A7Q2G9 A0A179R1N4 Q88GR9
NP_745785.1.35174 WP_010954490.1.28295 WP_010954490.1.28475 WP_010954490.1.3142 WP_010954490.1.31851 WP_010954490.1.32932 WP_010954490.1.34900 WP_010954490.1.41 WP_010954490.1.42045 WP_010954490.1.47320 WP_010954490.1.48025 WP_010954490.1.52680 WP_010954490.1.58218 WP_010954490.1.62773 WP_010954490.1.675 WP_010954490.1.71439 WP_010954490.1.87606 gi|386011704|ref|YP_005929981.1| 160488.PP_3649 gi|26990360|ref|NP_745785.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]