SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386012347|ref|YP_005930624.1| from Pseudomonas putida BIRD-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386012347|ref|YP_005930624.1|
Domain Number 1 Region: 10-239
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.1e-44
Family Alanine racemase-like, N-terminal domain 0.018
Further Details:      
 
Domain Number 2 Region: 207-354
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1e-28
Family Eukaryotic ODC-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386012347|ref|YP_005930624.1|
Sequence length 365
Comment protein NspC [Pseudomonas putida BIRD-1]
Sequence
MIKTPYYLIDKTKLLSNMEKIAYVREHSGAKALLALKCFATWSVFDLMQQYMDGTTSSSL
FELKLGRQKFAGETHAYSVAWADDEVEEMLENCDKIIFNSIGQLQRFADQSEGKVRGLRV
NPQVSSSDYLLADPARPFSRLGEWDPAKIEQVIEQISGFMFHNNCENGDFGLFDKMLTHI
EERFGHLLHKVEWVSLGGGIHFTGEDYAVDAFCARLKAFSEKYGVQVYLEPGEAAITNSA
SLEVTVLDTLYNGKHLAVVDSSIEAHLLDLLIYRLNAKMAPNDGEHTYMVCGKSCLAGDI
FGEYQFDRPLAIGDRLSFIDTAGYTMVKKNWFNGLKMPSIVVKQLDGSVEVVREFGFEDY
VSSLS
Download sequence
Identical sequences A0A0A7Q1Y8
gi|386012347|ref|YP_005930624.1| WP_014591215.1.31851 WP_014591215.1.34900 WP_014591215.1.42045 WP_014591215.1.47320 WP_014591215.1.48025 WP_014591215.1.62773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]