SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386012458|ref|YP_005930735.1| from Pseudomonas putida BIRD-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386012458|ref|YP_005930735.1|
Domain Number 1 Region: 26-131,197-511
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.02e-60
Family GABA-aminotransferase-like 0.00023
Further Details:      
 
Weak hits

Sequence:  gi|386012458|ref|YP_005930735.1|
Domain Number - Region: 704-766,821-881
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0144
Family LDH N-terminal domain-like 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386012458|ref|YP_005930735.1|
Sequence length 956
Comment Pyridoxalphosphate dependent aminotransferase, class III [Pseudomonas putida BIRD-1]
Sequence
MDYRDFVRPKFVGLLQALGLECEFQRALGSQLFYRNPKGDMVTVTDFLGGYGAALFGHND
PQFVDQLCALLRSDVPFNAQMSIRGAAGQLGRALSDAFNRELKNTERYISTFSNSGAEAV
EIAVKHAEFRRQKSLQKQFDDIDFTLASLTASEHAYRELDVADLDLPAGVLPATLNSVTL
RQVVEAVRQHNLAQLHIEPVFVALRGSFHGKLVNTVQLTYGRQYRAPFARFGLNVEFIDP
QQPHQLQELPARHTHHWLSLQWDSEHLNVLQLPFSAITAVLMEPIQGEGGINEFAAEFYL
GLRKLCNEQQCPLVVDEVQSGFGRAGTFLASSQFNLQGDYYCLSKALGGGLMKIAATVIR
SSHYEGEFSYIHSSTFAEDDPSCHIALSALRRLFANDDAMLKDIRTKGAYLKASLNELKM
AYPDVIADVRGRGLLVGLELHDLSVSSSLVQASAQYNDALGYLIAGYLLQFEALRVAPSG
SNSNVIRLEPPACITLGEIDGLIAALQRVCDMLRRGDALPLAAGICADSMPAVPARQDDF
RVAEPVENIDAKVEIVARVAFINHLIDADILGDVDPSLAALSPEQKRTFINRTKPERRAV
PVGPVIIRSRLGMAVEFTLYPLCMDSDAMAEYIRSGDLDSIREEVGRRVTDARADGCSIA
GLGMYTSIVTNNCQALKIADMALTSGNALTIGMGLEAIEQGCVQQGLALREQTAAVVGAA
GNVASTYASVLSATVDHLILIGSGRDGSVRRLEKTAQQIYADAARSILKGTAEHDRLAQR
LLTLDGFCDLLHSHGQKADLGLHIARLMDERLGANAFITVTNDLDAIKGARIVLCAANAP
QPFLGAEHFAERSVICDIAVPLNVHQDLPSQREDVLYMHGGIVQTPFDDGLAPNVRAYLK
KGQLYACMAESVLMGLSGMSQHGSYGDISREQVQQVRALAATHGFTLAQFKTQNSL
Download sequence
Identical sequences WP_014591311.1.34900 gi|386012458|ref|YP_005930735.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]