SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386013097|ref|YP_005931374.1| from Pseudomonas putida BIRD-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386013097|ref|YP_005931374.1|
Domain Number 1 Region: 16-268
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.44e-57
Family Alanine racemase-like, N-terminal domain 0.0000000991
Further Details:      
 
Domain Number 2 Region: 239-407
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.76e-54
Family Eukaryotic ODC-like 0.00000311
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386013097|ref|YP_005931374.1|
Sequence length 410
Comment protein LysA [Pseudomonas putida BIRD-1]
Sequence
MTAPFTLLAEAVRQHGSPLWAYDTRTIADRVKQLNVFDTVRFAQKANPNLHVLRLMRAHG
LVLDAVSLGEMERAFAAGASVDGDPAGVVLTCDALDRPTLERVVASKIEVNAGSIDMLRQ
LGERSPGHRVWIRINPGFGHGHSRKTNTGGENSKHGIWHEELDEALACIKAHGLHLVGVH
MHIGSGVDYQHLEQVARSMIELIGRLGVDIEAFSIGGGLSTPYRSTDKPVDLQRYAQTWA
VARKEIEAMLGHPVRMEIEPGRFLVAESGYLVAEVRAVKQVGRNTFVMIDAGFNDLMRPA
MYGAYHGMTLLDADGQAVDRPRQPTVVAGPLCESGDVFTQDDQALTPQDLPQAQVGDLLV
IHDAGAYGASMSSNYNSRPLLPEFLIENGALRMIRRRQTVQDLLSLEAGF
Download sequence
Identical sequences WP_014591823.1.34900 WP_014591823.1.47320 gi|386013097|ref|YP_005931374.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]