SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|552738029|ref|YP_008689997.1| from Streptococcus sp. I-G2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|552738029|ref|YP_008689997.1|
Domain Number 1 Region: 3-82,178-340
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 7.22e-52
Family Bacterial dinuclear zinc exopeptidases 0.0000016
Further Details:      
 
Domain Number 2 Region: 70-183
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 9.77e-29
Family Aminopeptidase/glucanase lid domain 0.00000789
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|552738029|ref|YP_008689997.1|
Sequence length 345
Comment peptidase M42 [Streptococcus sp. I-G2]
Sequence
MNQTVEYLKELTALASPTGFTEEVATYLVKTLTDMGYSPVRTAKGGVTVVLKGENDEQHR
YITAHVDTLGAIVRAVKPDGRLKLDRIGGFPWNMIEGENCTVHVANTGKTHSGTILVHQT
SCHVYKDAGTVERTQDNMEVRLDEKVTSEKETRDLGIEVGDFISFDARTIVTDTGFIKSR
HLDDKVSAAILLNLLRVYKEEGVTLPVTTHFAFSVFEEVGHGANSSIPAQAVEYLAVDMG
AMGDDQQTDEYTVSICVKDASGPYHYGFRQHLVALAKEQNIPYKLDIYPFYGSDASAAMS
AGAEVKHGLLGAGIESSHSYERTHVDSVVATERMVDAYLKSDLVK
Download sequence
Identical sequences U5PC74
WP_023027028.1.3708 gi|552738029|ref|YP_008689997.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]