SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|552738823|ref|YP_008690817.1| from Streptococcus sp. I-G2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|552738823|ref|YP_008690817.1|
Domain Number 1 Region: 121-270
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 2.62e-46
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00015
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 5.56e-29
Family DHN aldolase/epimerase 0.00048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|552738823|ref|YP_008690817.1|
Sequence length 274
Comment 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase [Streptococcus sp. I-G2]
Sequence
MDQLRIKDLEIYAYHGVFSAEKELGQRFVLDVCVDYEMTKSARTGDLTASIHYGILAEQL
TDWLQAEKIDLIETVAFQLVEKIFATYEFVRKVRLELKKPWAPVPLPLDTCSVTIEREKR
RAFIGLGTNMGDKGHQLATAVSKLEEKGLTILQTSSQIETAPWGGVEQDSFLNQVVEVES
WFTPQDLIDTLLGIEREMGRVREVKWGPRVIDLDLLYMEDLILYSTDLILPHPYVAERAF
VLESLNEIAPYFVDPVQRKQIRQLWETVKETKDT
Download sequence
Identical sequences U5PBE5
gi|552738823|ref|YP_008690817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]