SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000013 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000013
Domain Number 1 Region: 7-121
Classification Level Classification E-value
Superfamily Ubiquitin-like 9.04e-43
Family GABARAP-like 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000013   Gene: ENSGACG00000000010   Transcript: ENSGACT00000000013
Sequence length 122
Comment pep:known_by_projection scaffold:BROADS1:scaffold_89:59954:62169:-1 gene:ENSGACG00000000010 transcript:ENSGACT00000000013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EMPSDRPFKQRRTFADRCKEVQQIRDQHPNKIPVIIERYKGEKQLPVLDKTKFLVPDHVN
MSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTAISQIYEQERDEDGFLYMVYASQETF
GC
Download sequence
Identical sequences G3N3Z6
ENSGACP00000000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]