SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000014 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000014
Domain Number 1 Region: 12-126
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.27e-42
Family GABARAP-like 0.00000502
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000014   Gene: ENSGACG00000000010   Transcript: ENSGACT00000000014
Sequence length 133
Comment pep:known_by_projection scaffold:BROADS1:scaffold_89:60168:62190:-1 gene:ENSGACG00000000010 transcript:ENSGACT00000000014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VITATEMPSDRPFKQRRTFADRCKEVQQIRDQHPNKIPVIIERYKGEKQLPVLDKTKFLV
PDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTAISQIYEQERDEDGFLYMVYA
SQETFGCAQVAAP
Download sequence
Identical sequences G3N3Z7
ENSGACP00000000014 69293.ENSGACP00000000014 ENSGACP00000000014

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]