SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000064 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000064
Domain Number 1 Region: 30-471
Classification Level Classification E-value
Superfamily Ras GEF 1.18e-114
Family Ras GEF 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000064   Gene: ENSGACG00000000049   Transcript: ENSGACT00000000064
Sequence length 473
Comment pep:known_by_projection scaffold:BROADS1:scaffold_520:3363:14730:-1 gene:ENSGACG00000000049 transcript:ENSGACT00000000064 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQTPPFTGQLNTGVYNKNLYQAKEEGYSGLYYHDNNLASGSLEALIHHLVPTVDYYPDR
TYIFTFLLSSRLFIRPHELMSKVCHLCMEQQRLSDPQADKMRVRKIAPKVLQLLTEWTET
FAYDFRDEKTMRSLKELTHRLANGDEVYRKAVGQMSQALIRRLTALSQYEEALVKINAAA
AERLTSLKAKPQASIQRDMLSICNDPFAVAQQLTHIELERLSYIGPEEFVQAFVQKDPLD
NDKSCFSDHKKASSLEAYVDWFNRLSYLVATEICLPVKKKQRARVMEFFIDVARECFNIG
NFNSLMAIISGMNMSPVSRLKKTWNKVKTAKFDILEHQMDPSSNFYNYRTALRGATQRSV
TANSSREKIVVPFFSLLIKDIYFLNEGCANRLQSGHVNFEKFWELAKQVSEFMAWKKVEC
PFEKDRKILQYLLTAPVFTEDALYLASYESEGPENHMEKDRWKSLRSSLLSRV
Download sequence
Identical sequences G3N446
ENSGACP00000000064 ENSGACP00000000064 69293.ENSGACP00000000064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]