SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000065 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000065
Domain Number 1 Region: 40-292
Classification Level Classification E-value
Superfamily Ras GEF 1.18e-46
Family Ras GEF 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000065   Gene: ENSGACG00000000049   Transcript: ENSGACT00000000065
Sequence length 295
Comment pep:known_by_projection scaffold:BROADS1:scaffold_520:8574:14763:-1 gene:ENSGACG00000000049 transcript:ENSGACT00000000065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSAPLSPLQGNMPQTPPFTGQLNTGVYNKNLYQAKEEGYSGLYYHDNNLASGSLEALIHH
LVPTVDYYPDRTYIFTFLLSSRLFIRPHELMSKVCHLCMEQQRLSDPQADKMRVRKIAPK
VLQLLTEWTETFAYDFRDEKTMRSLKELTHRLANGDEVNACVLKAVGQMSQALIRRLTAL
SQYEEALVKINAAAAERLTSLKAKPQASIQRDMLSICNDPFAVAQQLTHIELERLSYIGP
EEFVQAFVQKDPLDNDKSCFSDHKKASSLEAYVDWFNRLSYLVATEICLVRDTRR
Download sequence
Identical sequences G3N447
ENSGACP00000000065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]