SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000082 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000082
Domain Number 1 Region: 530-727
Classification Level Classification E-value
Superfamily Sec7 domain 3.14e-66
Family Sec7 domain 0.00000608
Further Details:      
 
Domain Number 2 Region: 751-875
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000287
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000082   Gene: ENSGACG00000000063   Transcript: ENSGACT00000000082
Sequence length 939
Comment pep:novel scaffold:BROADS1:scaffold_99:60463:72490:-1 gene:ENSGACG00000000063 transcript:ENSGACT00000000082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWCLQCNSEKTQSLLELELNGCVEGDGRPNESGPSLDGGASFGQGPVTHGSAISPDRFDG
PLYSHGVQPGPQRPRRPKLQHSQSILRKQAEEEAIKRSRSLSESYELSADLQDKQVEMLE
RKYGGRFITRHAARTIQTAFRQYQMNKNFERLRSSMSENRMSRRIVLSNMRMQLSFEGPE
KVHSSYFEGRQVSMTEDGAPLSMMQSERGDIEVHQQANMASHPAPQGDLTDAITELEDAF
SRQVKSLAESIDDALNCRSLQGDEGPDQSEAMGCPKGEREVSYQAKSHRRAAGRMHDEAL
ASYSDVTLFIDEEDVSPSNALSRSGEQPSSTESDLRLRSVNSSQDYWPMDPKDEGRDTDT
SCRSTPSLECQEQRLRMDHLPLLTIEPPSDSSAEHSDRSDRGSVKRPPAYEPHGHVVRSS
QASPKHISHGPPTRGSSRDDDAPLRHRHRQLEGHLAINGSANRQSKSESDFSDGDNDSIN
STSNSNDTINCSSESSSRDSLREQTLSKQTYHKETRNSWDSPIFSNDVIRKRHYRIGLNL
FNKKPEKGIQYLTERGFIPDTPVGVAHFLLQRKGLSRQMIGEFLGNRQKQFNRDVLDCVV
DEMDFQSMELDEALRKFQNHIRVQGEAQKVERLIEAFSQRYCICNPTVVRQFRNPDTIFI
LAFAIILLNTDMYSPNVKPERKMKMEDFIKNLRGVDDGEDIPRETLVGIYERIRKRELKT
NEDHVSQVQKVEKLIVGKKPIGSLHHGLGCVLSLPHRRLVCYCRLFEVPDPNKLQKLGLH
QREIFLFNDLLVVKALSLKKKNSVTYSFRQSFSLYGMQVIMFENQYYPNGIRLTSAIPGA
DIKVLINFNAPNPQDRKKFTDDLRESIAEVQEMEKYRIESELEKQKGMVRPSMSQSSGLK
KEAGNGNMNRASLDDTYAMGEGLKRSALSSSLRDLSEAG
Download sequence
Identical sequences G3N464
ENSGACP00000000082 ENSGACP00000000082 69293.ENSGACP00000000082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]