SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000096 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000096
Domain Number 1 Region: 284-360
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000111
Family PHD domain 0.033
Further Details:      
 
Domain Number 2 Region: 841-895
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000122
Family PHD domain 0.0074
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000096
Domain Number - Region: 713-755
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00244
Family PHD domain 0.01
Further Details:      
 
Domain Number - Region: 422-455
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.046
Family PHD domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000096   Gene: ENSGACG00000000074   Transcript: ENSGACT00000000096
Sequence length 899
Comment pep:known_by_projection scaffold:BROADS1:scaffold_58:393130:437552:1 gene:ENSGACG00000000074 transcript:ENSGACT00000000096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDRSVKRRQVKPLAASLLDALDYDSSDDSDFEVGDASGSDGTGNNSDEEGSKASAAGSGT
DEDNNNAVSADNGIDEDEAKDLAAEDNLTEDERKTKEQASSDSSTKDTPAAEPPKGRRRS
KKVSESEPAAGACTESTSTSTCGSVNTEEPQAEPKKWNFRRNRPLLDFTTMEELNEMDDY
DSEDDNDWRPVAGKKKGKAGGQKEGAEEEEDGGSGSASEDDEDDDNDEDDDNDDDEDEDD
DKEDGDDATTTNTTTTPTNNNNNNNNNNSSSESDKDDALLERSQTWNTQHILICCVCLGD
NSEDADEIIQCDNCGVTVHEGCYGVDGESDSIMSSASENSTEPWFCDACKNGVTPSCELC
PNQDGIFKETDAGRWVHVVCALYVPGVAFGDIDKLRPVTLTEMNYSKYGAKASTPFTYGG
IECSFCEDARFARTGVCISCDAGMCRSYFHVTCAQREGLLSEAAAEEEIADPFFAYCKQH
ADRFDRKWKRKNYLALQSYCKVSLQEREKQLTPEAQARITTRLQQYRAKAELSRNTRPQA
WVPREKLPRPLTSSASAIRKLMRKAELMGISTDIFPVDTSDTNASLDGRRKHKQPALTAD
FVNYYLERNMRMIQIQDNISEQKNLKDKLESEQEKLHVEYNKLCESLKELLNVNGELRSE
GQAIWTLLGGILGQKLNTPAVLKAPKERKPSKKEGGSPGKSSSLPAILYRRNQDQHLLVL
CDTCSCLPPGCLEPPLTRMPKKTNNSYWQCSECDQASSDEADIAMETLPDGTKRSRRQVK
GPIKFIPQEMSPEPKKHQRTRGQKRKRVPMSEDREDKAEEPLPRERRQRQSAMQKKPKAD
DTRTECTTCSGPGDNENLVRCDECRLCYHFGCLDPPLKKSPKQTGYGWICQDCDTSSSK
Download sequence
Identical sequences G3N476
69293.ENSGACP00000000096 ENSGACP00000000097 ENSGACP00000000096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]