SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000098 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000098
Domain Number 1 Region: 96-302
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-56
Family DBL homology domain (DH-domain) 0.00026
Further Details:      
 
Domain Number 2 Region: 285-437
Classification Level Classification E-value
Superfamily PH domain-like 1.35e-31
Family Pleckstrin-homology domain (PH domain) 0.003
Further Details:      
 
Domain Number 3 Region: 558-653
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000262
Family Pleckstrin-homology domain (PH domain) 0.00042
Further Details:      
 
Domain Number 4 Region: 477-531
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000351
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000098   Gene: ENSGACG00000000079   Transcript: ENSGACT00000000098
Sequence length 681
Comment pep:known_by_projection scaffold:BROADS1:scaffold_99:263423:274542:1 gene:ENSGACG00000000079 transcript:ENSGACT00000000098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LDNADSSEQHGKIPNRDSGIDSPSCAAEGEVFPNEDAIDEEDHYDSVTETESVSCCVTLG
NKRDSTQDEDSDLDEGSGGEIQSLAEAQAGDLTDGHSETQNLLNIAKELLHTEEAYVKRL
NLLDQVFCTKLTETGIPQDVITGIFSNISSIYCFHDKFLLPELKTRITGEWDSNPRIGDI
LQKLAPFMKMYGEYVKNFDRAMDLVNTWTQRSSQFKSVVQNIQKQDVCGNLTLQHHMLEP
VQRIPRYELLLKDYLKKLPGDALDRKDAEKAVELISTAANHSNAAIRKMEKMHKLLEVYE
RLGGEEDIVNPANELIKEGHIKKMSAKNGTAQDRYLYLFNNMVLYCVPKLRLMGQKFSVR
EKIDIAGMEVQENVKQNLPHTFAIIGKQRSLELQARTAEEKEDWIQVILATIERHKQNSE
TFNKAFNSSLSRDDDQHPPESPPFNSQGTPPSDPHLVFSKRRGSLSPSCLMSSRKKEKEK
QTCKGCNESFNFTKRKHHCKSCGASICAKCSKNLDNKTSRMCPECFEASVSLDTVSVSEQ
KRKAASERQTSLTGENCLLCGHLQLQEKGKSWSKMWGAVTKAEPLVLYLQSSGQDSKGAR
PVPLAGFEVSAAPSGGEKPEVRHAFRLSHTQQTLLLSAPDAELQAKWVEVLSISSFDRTT
RSSPFNLPPRDHTAPSSVSVP
Download sequence
Identical sequences G3N478
ENSGACP00000000098 ENSGACP00000000098 69293.ENSGACP00000000098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]