SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000136 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000136
Domain Number 1 Region: 107-319
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.57e-61
Family DBL homology domain (DH-domain) 0.0000000691
Further Details:      
 
Domain Number 2 Region: 304-459
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-44
Family Pleckstrin-homology domain (PH domain) 0.00000249
Further Details:      
 
Domain Number 3 Region: 11-130
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-22
Family SH3-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000136   Gene: ENSGACG00000000105   Transcript: ENSGACT00000000136
Sequence length 522
Comment pep:known_by_projection scaffold:BROADS1:scaffold_95:296766:312536:1 gene:ENSGACG00000000105 transcript:ENSGACT00000000136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFQHGRSRTQLISDGSVVYAEALWDHVTMDDQELGFKAGDVIEVVDATNKEWWWGRIMD
SEGWFPASFVRLRVNQDEPMDDYLTHLEDAHAGEENREGLGAILGPGLPCKEQMRTNVIN
EIMSTERDYIKHLKDICEGYVKQCRKRTDMFTEEQLCTIFGNIEEIYRFQRKFLKGLEKN
FNKEQPHLSEIGCCFLEHQTDFQIYSEYCNNHPNACIQLSKLVKVNKYVFFFEACRLLQK
MIDISLDGFLLTPVQKICKYPLQLAELLKYTNPQHRDYTDVEAALNAMKNVARLINERKR
RLENIDKIAQWQSSIEDWEGEDVLSRSSDLIFSGELSKLSHPHAKSQQRMFFLFDHQMVY
CKKDLLRRDMLYYKGRMDMDCMQVIDVEDGKEKDFNISVKNALKLQALAGDETHLLCSKK
PEQKQRWLRAFADERIQVQHDCETGFSLTEVQKKQAMLNARKTHPAGKPKAVTRPYYDFL
MRQKHPSLPTALPQQQVFMLAEPKRKTSTFWHNIGRLTPFKK
Download sequence
Identical sequences G3N4B6
ENSGACP00000000136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]