SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000216 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000216
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-31
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000216   Gene: ENSGACG00000000163   Transcript: ENSGACT00000000216
Sequence length 450
Comment pep:known_by_projection scaffold:BROADS1:scaffold_216:66245:70541:-1 gene:ENSGACG00000000163 transcript:ENSGACT00000000216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RAPVCLLPPRPSHSDSYIVRVKAVVMTRDDSSGGWLAQDGGALSRVGVCRLLPPELAPAP
PFGCSHFLIRGERLRDKQVILDCPLRKGLVYTIATPTFHHWKVEDRKCGLSFQSLADARA
FDRGVRKAIEDLAEGSIRASCVCLCPQSTTDSSSNSSQKLEPPEPSPPPQRHRCMQGHRH
DLHDPYQLSDPYVPDQPLSRRPRQVTFHEDDEIVRINPRERSWERTAERHYGHPSHRPLL
KGYEDYRHATVRDKFIQADDSESYVHFAKTEARKHDYTYPLAPALSPSDSDPALGPLDNK
GHGGAYRQGVPACVVSAQPRSFLPSSSHSANGGKGRKDEPERAQCEHCGEAFYVAANRRG
RCHDAPDPVGACVRRVSCMWLADTMLYHCMSDPEGDYSDPCSCDRLGSRWLALLGLSLVA
PCLCLYPPLHACHRAALRCGCCGGRHKALS
Download sequence
Identical sequences G3N4J6
69293.ENSGACP00000000216 ENSGACP00000000216 ENSGACP00000000216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]