SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000217 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000217
Domain Number 1 Region: 12-128
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-31
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000217   Gene: ENSGACG00000000163   Transcript: ENSGACT00000000217
Sequence length 437
Comment pep:known_by_projection scaffold:BROADS1:scaffold_216:66245:70526:-1 gene:ENSGACG00000000163 transcript:ENSGACT00000000217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPPRPSHSDSYIVRVKAVVMTRDDSSGGWLAQDGGALSRVGVCRLLPPELAPAPPFGCS
HFLIRGERLRDKQVILDCPLRKGLVYTIATPTFHHWKVEDRKCGLSFQSLADARAFDRGV
RKAIEDLAEALSSFSARLGEEIKVGCSEGFSTTDSSSNSSQKLEPPEPSPPPQRHRCMQG
HRHDLHDPYQLSDPYVPDQPLSRRPRQVTFHEDDEIVRINPRERSWERTGYEDYRHATVR
DKFIQADDSESYVHFAKTEARKHDYTYPLAPALSPSDSDPALGPLDNKGHGGAYRQGVPA
CVVSAQPRSFLPSSSHSANGGKGRKDEPERAQCEHCGEAFYVAANRRGRCHDAPDPVGAC
VRRVSCMWLADTMLYHCMSDPEGDYSDPCSCDLGSRWLALLGLSLVAPCLCLYPPLHACH
RAALRCGCCGGRHKALS
Download sequence
Identical sequences G3N4J7
ENSGACP00000000217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]