SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000301 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000301
Domain Number 1 Region: 15-116
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-27
Family Phosphotyrosine-binding domain (PTB) 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000301   Gene: ENSGACG00000000236   Transcript: ENSGACT00000000301
Sequence length 249
Comment pep:known_by_projection scaffold:BROADS1:scaffold_402:760:2611:1 gene:ENSGACG00000000236 transcript:ENSGACT00000000301 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALHCVSVCGSVRDVRVCVRRTEASERCRLKGDGFLRADVDALLLLGRSGEEVLTWPYRYL
RRFGRDKSTFSFEAGRRCDSGEGSFEFETQRGNFLFQAVESAINRQRISFPQRQTSYQAG
PEAAEDPPLVPSRTAPLPQLRGHVPQSAAAQGVDDVYSMVSQTPTIQKSHHRDKDSSSPS
HQKPQQRLQTRLEPPVEKMLTGVKSLTLDTRGHLPPHKNQVKMISSLPLPHAEPGPHKTY
SQIVLPGDS
Download sequence
Identical sequences G3N4T1
ENSGACP00000000301 69293.ENSGACP00000000301 ENSGACP00000000301

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]