SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000438 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000438
Domain Number 1 Region: 16-117
Classification Level Classification E-value
Superfamily SWIB/MDM2 domain 3.79e-42
Family SWIB/MDM2 domain 0.0000725
Further Details:      
 
Domain Number 2 Region: 291-335
Classification Level Classification E-value
Superfamily Ran binding protein zinc finger-like 3.14e-18
Family Ran binding protein zinc finger-like 0.00038
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000438
Domain Number - Region: 435-477
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0764
Family TFIIH p44 subunit cysteine-rich domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000438   Gene: ENSGACG00000000347   Transcript: ENSGACT00000000438
Sequence length 490
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:219652:224669:1 gene:ENSGACG00000000347 transcript:ENSGACT00000000438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSLSAQLPASSPSCRTLPGDGNQVQPKAPLLQILRVAGAKEDVFTLKEVMHYLGQYIMG
KQLYDKQRQHIVHCQDDPLGELLEVESFSVKNPSPVYEMLKKYLVVLGCSDAAENLSVGR
ECVESGVEDRGQTCGGVVKAGLETSIDKPLLQTPSQRRPREPDDDSLEDLPRSACKRPKL
DVSLDEWDLSGLPWWFLGNLRSNYSRRSNGSTDIHTNQEEDTAIVSDTTDDLWFLTEGGS
EQVSVEMKEAALEEGSSGEEEALSDDNEGGREEKADREMQEEPDEDSQCLSDDTDTEIST
QDAWQCTECKKYNTPLQRYCVRCWALRKNWYKDVPRLAHSLSVPDIPACSSLPTNDEEDD
SDTGIDIPDCSRTVSDPVILPSHSTADRPLPTMATGKVKGPWPPGFHKDGKLSGGASQDN
PGMEIEDEKLRELLEPCKLCRVRPRNGNIIHGPTAHLLTCFPCARKLHKFNAPCPGCGMI
IQNVIKAFVV
Download sequence
Identical sequences G3N568
ENSGACP00000000438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]