SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000474 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000474
Domain Number 1 Region: 629-693,890-1204
Classification Level Classification E-value
Superfamily Ras GEF 9.42e-76
Family Ras GEF 0.0003
Further Details:      
 
Domain Number 2 Region: 227-449
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.06e-38
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 3 Region: 24-135
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-16
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 4 Region: 437-588
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000851
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000474   Gene: ENSGACG00000000366   Transcript: ENSGACT00000000474
Sequence length 1206
Comment pep:known_by_projection scaffold:BROADS1:scaffold_168:115805:132206:1 gene:ENSGACG00000000366 transcript:ENSGACT00000000474 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKGVRYNEGHALYLSVVARKEGSKRGFLSRKTAENGRWAEKYFALHQNVLFYFDNDQSA
RPSGIYLLEGCACERAPAPKQGAAGEAADRLVAFPAQHYFLVIFGHDGQKPLELRSEEES
DCNEWVECIQQASYSDIIIEREILMQKYIHLVQIMETEKIAANQLRTQLEDQDAEIERLK
VSNIIECSKPKGRMQPQQLNPEEEDPTSKRIKKVQSFMRGWLCRRRWKIIVQDYISSPHA
ESMRKRNQIVFNMVEAETEYVHQLSILVNCFLRPLRMAASSKKPPISHDDVSTVFLNSET
IMFLHEIFHGLKARIANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDF
DKLLKQYESNAACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKL
EELSNRMMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFVRQGSLVQLPSSSEREML
SKVRLGSLSLRKEGERQCFLFTKHFLICTRTSEERLHLLKQGGTLSLIECTLIEELEASD
EDYNAAGQGFNHLEFKVVVEPPDGGSFSVVLLAPSRQEKAAWTSDISQQCIDNIRCNGLM
TSVFEENSKVSVPHMIKSDARLHKDDVDICFSKTLNSCKVPQIRYASVERLLERLTDLRF
LSIDFLNTFLHTYRIFTTAAVVIDKLADIYKKPFTSIPVRCLQCLILMSCRGDVHSLHLC
ISACSSVRPFFIRHPASSSSSSRCHCPRIEQLSCDRLSIMSLCPDYSLKITQLALDQSKS
PGRQDVGGELPCIDAFCGKLRRSIRRAVLETVSLDKFFPDSPGGVEAGDMSPCRSPSTPR
HLRYRQSGGSTLSPGDNSRCTMSSASAFAIATAAAGHGSSQAFTGSDKVCDKEFIIRRAA
TNRVLNVLRHWVSKHSQDFDMSSELKMGVICLLEEVIRDPDLLPQERKATSNILSALSQE
DQDDAQLKIEDILQMAENPKAECFESLSAMELAEQITLLDHIVFRGIPYEEFLGQGWMKV
DKTERTPYIMKTSQHFNDMSNLVASQIMTHTDVGSRAGAIEKWLAVADICRCLNNYNGVL
EITSALNRSAIYRLKKTWAKVCKQVRMXPNFSKEGPRRMVRCFIPSTNPLNESDALVKKT
YILDGKSSFVIPPSLTSSGEIRQVQQAPYRIEHQPQVTQFLLDKTLVMDEDTLYELSLKI
EPRVPP
Download sequence
Identical sequences G3N5A4
69293.ENSGACP00000000474 ENSGACP00000000474 ENSGACP00000000474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]