SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000486 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000486
Domain Number 1 Region: 10-245,299-334
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.56e-58
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000486
Domain Number - Region: 319-368
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0211
Family Ubiquitin-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000486   Gene: ENSGACG00000000376   Transcript: ENSGACT00000000486
Sequence length 711
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:657210:665823:1 gene:ENSGACG00000000376 transcript:ENSGACT00000000486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTASTANYLWSLQDVLGQGATASVYKARNKRLGELVAVKVFNSVSYNRPHEVQMREFEML
RRLKHSNIVRLYAVEECNNLPSKQNVLVMEYCSGGSLLSLLEESENAFGLPETEFLIVLQ
CVVQGMNHLRENGVVHRDIKPGNIMRQVGEDGKSVYKLTDFGAARVLEDDEKFMSIYGTE
EYLHPDMYERAVLRKPHQKSYGVSVDLWSIGVTFYHAATGSLPFAPFGGPRKNKPTMYKI
TTEKPMGAIAGIQRVEGGQIEWSYHLPHSCQLSQGLAMHLVPILAGILEADQERCWGFDQ
FFKATTDVLQRQPVHLFSLHQAMAHCVYIHHYNTVLMFLEEVASQTGIAVQLQHLLYLGH
KLPLEGNMKVANLPHTSHDRPLILLSGPDTNGSFPFREPDTPVIPSRFDVIADYNFSKVI
VGVVHQYLRLVQSLHTHSGLLLQGYYSYMMMFRGECEEAVHTIAMITIRLQCCLTTEQRT
HTLCNSIPNFRFFPPLSALSPQVREHLPIYSAGIHEFHSRLNHLQIEQAKLAETLANDQS
CQKMEMLKQRITTIHQHYRKDRQTGKLAYNDEQIHKFEKIHLSSHIKRVKSLLREDCVLR
YKELLATTKKWSSLNWQKHISVLKSVISSVLLEMKTRLQDFSSFSTDLLAEVEMNEHHLN
KSKQTGQQPEIKDQMVSRMHHLKEEMEMLVRELQCNNSIIESLGTTLMPSV
Download sequence
Identical sequences G3N5B6
ENSGACP00000000486

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]