SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000489 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000489
Domain Number 1 Region: 1-120,174-209
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.52e-26
Family Protein kinases, catalytic subunit 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000489
Domain Number - Region: 194-243
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0157
Family Ubiquitin-related 0.018
Further Details:      
 
Domain Number - Region: 450-547
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 0.0439
Family Aldose 1-epimerase (mutarotase) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000489   Gene: ENSGACG00000000376   Transcript: ENSGACT00000000489
Sequence length 591
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:658148:665333:1 gene:ENSGACG00000000376 transcript:ENSGACT00000000489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNHLRENGVVHRDIKPGNIMRQVGEDGKSVYKLTDFGAARVLEDDEKFMSIYGTEEYLHP
DMYERAVLRKPHQKSYGVSVDLWSIGVTFYHAATGSLPFAPFGGPRKNKPTMYKITTEKP
MGAIAGIQRVEGGQIEWSYHLPHSCQLSQGLAMHLVPILAGILEADQERCWGFDQFFKAT
TDVLQRQPVHLFSLHQAMAHCVYIHHYNTVLMFLEEVASQTGIAVQLQHLLYLGHKLPLE
GNMKVANLPHTSHDRPLILLSGPDTNGSFPFREPDTPVIPSRFDVIADYNFSKVIVGVVH
QYLRLVQSLHTHSGLLLQGYYSYMMMFRGECEEAVHTIAMITIRLQCCLTTEQRTHTLVR
LVREHLPIYSAGIHEFHSRLNHLQIEQAKLAETLANDQRYSRPTRILSRREVYCVFLTLT
FCLPHSCQKMEMLKQRITTIHQHYRKDRQTGKLAYNDEQIHKFEKIHLSSHIKRVKSLLR
EDCVLRYKELLATTKKWSSVLLEMKTRLQDFSSFSTDLLAEVEMNEHHLNKVNFVCVECL
CSLDQILWHAVHMYPCIDKELVFPCSRMHHLKEEMEMLVRELQCNNSIIER
Download sequence
Identical sequences G3N5B9
ENSGACP00000000489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]