SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000490 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000490
Domain Number 1 Region: 224-262
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000072
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000490   Gene: ENSGACG00000000383   Transcript: ENSGACT00000000490
Sequence length 262
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:667434:680504:1 gene:ENSGACG00000000383 transcript:ENSGACT00000000490 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVSVVGQHPGPHRLDSEPLLFKRTGGRRKITLPRKSSWEKMKFRRSSASGAECASSAT
TEALGPAGETVERGELVSAEGCRVAAPRSLLRGGGADCDGSTTAGTGESHTGGTDSDCST
HRDSNRHAGRREASLNVTPSGALTNGHKGAHRHRDAPHGRRDPGSGHEVISSSGSPCARP
GSLPLERLTQGKTGVVKLARNEPHRRQAWSIFPRGGDPRVRTERGEGHWFESKPCTHDWC
DACSRQITAQALMCQNCSYTCH
Download sequence
Identical sequences G3N5C0
ENSGACP00000000490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]