SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000535 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000535
Domain Number 1 Region: 544-669
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-19
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 2 Region: 83-301
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000297
Family HspBP1 domain 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000535   Gene: ENSGACG00000000412   Transcript: ENSGACT00000000535
Sequence length 723
Comment pep:novel scaffold:BROADS1:scaffold_27:831226:846856:-1 gene:ENSGACG00000000412 transcript:ENSGACT00000000535 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAADIVKVAIEWPGANAQLIEMDQKRPLSSIIREVCDGWSLSGSEQFALRYADGPQLY
ITEQSRGEIKNGTILRLAISPARAARQLLERIQSHGIDARLEALKELAKLSADPTFAAEF
INMEGIGTLARLVESGTHFGEMLAFTLTAFLELMDHGIVSWDLISLSFIKQIAGYVNQPM
VDVSILQRSLAILESMVLNSHSLYHRVAQEITVGQLIGHLQVSNQEIQTYAIALINALFL
KAPEDRRQEEYTNPLEQHLTEMASTLAQKHLRSIILNHVIRGNRPIKAEMAHQLYVLQVL
TFNLLEERMMTKMDPNDQAQRDIIFELRRIAFDGENDPTGTEKRKAMYTKDYKMLGFTNH
VNPAMDFTQTPPGMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRCAIELTRML
CEILQVGELPNEGCNDYHPMFFTHDRAWEEFFCVCIQLLNKTWKEMRATAEDFNKVMQVV
REQITRALAMKPSSLDQLKNKLRGLNYSEILRLRQSERMSQDDFQSPPIIELRERIQPEI
LELIKQQRLNRLCEGSCFRKLGNRRRQEKFWFCRLSLNHKVLHYGDLDESPQGEVPFEQL
SDKIPVSDIKSVVTGKDCPHMKEKSALKQNKEVLELAFSVLYDPDETLNFVAPTKYEYCI
WTDGLCALLGREMGSDLTRSDLDTLISMEMKLRLLDLENITIPEAPPPVPKEPSSYNFTY
NYS
Download sequence
Identical sequences G3N5G2
69293.ENSGACP00000000535 ENSGACP00000000535 ENSGACP00000000535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]