SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000537 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000537
Domain Number 1 Region: 532-657
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-19
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 2 Region: 83-262
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000151
Family HspBP1 domain 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000537   Gene: ENSGACG00000000412   Transcript: ENSGACT00000000537
Sequence length 711
Comment pep:novel scaffold:BROADS1:scaffold_27:831226:842098:-1 gene:ENSGACG00000000412 transcript:ENSGACT00000000537 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPAADIVKVAIEWPGANAQLIEMDQKRPLSSIIREVCDGWSLSGSEQFALRYADGPQLY
ITEQSRGEIKNGTILRLAISPARAARQLLERIQSHGIDARLEALKELAKLSADPTFAAEF
INMEGIGTLARLVESGTHFGEMLAFTLTAFLELMDHGIVSWDLISLSFIKQIAGYVNQPM
VDVSILQRSLAILESMVLNSHSLYHRVAQEITVGQLIGHLQVSNQEIQTYAIALINALFL
KAPEDRRQEMASTLAQKHLRSIILNHVIRGNRPIKAEMAHQLYVLQVLTFNLLEERMMTK
MDPNDQAQRDIIFELRRIAFDGENDPTGTEKRKAMYTKDYKMLGFTNHVNPAMDFTQTPP
GMLALDNMLYLAKVHQDTYIRIVLENSSREDKHECPFGRCAIELTRMLCEILQVGELPNE
GCNDYHPMFFTHDRAWEEFFCVCIQLLNKTWKEMRATAEDFNKVMQVVREQITRALAMKP
SSLDQLKNKLRGLNYSEILRLRQSERMSQDDFQSPPIIELRERIQPEILELIKQQRLNRL
CEGSCFRKLGNRRRQEKFWFCRLSLNHKVLHYGDLDESPQGEVPFEQLSDKIPVSDIKSV
VTGKDCPHMKEKSALKQNKEVLELAFSVLYDPDETLNFVAPTKYEYCIWTDGLCALLGRE
MGSDLTRSDLDTLISMEMKLRLLDLENITIPEAPPPVPKEPSSYNFTYNYS
Download sequence
Identical sequences G3N5G4
ENSGACP00000000537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]