SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000585 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000585
Domain Number 1 Region: 436-683,710-778
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1e-54
Family Diacylglycerol kinase-like 0.014
Further Details:      
 
Domain Number 2 Region: 8-154
Classification Level Classification E-value
Superfamily EF-hand 1.82e-29
Family EF-hand modules in multidomain proteins 0.0021
Further Details:      
 
Domain Number 3 Region: 237-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 3.74e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 
Domain Number 4 Region: 129-232
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000000115
Family Calmodulin-like 0.057
Further Details:      
 
Domain Number 5 Region: 301-361
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000478
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000585   Gene: ENSGACG00000000456   Transcript: ENSGACT00000000585
Sequence length 797
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:936401:947212:-1 gene:ENSGACG00000000456 transcript:ENSGACT00000000585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSEDTEGSLTPVDFIQLQHYMEYSSQRVKDVIKEFQPGGRLAQHSFKEIVDVCPQRVD
AVGFCLFLKTYLEVDDFPADFCQRLFHYFQHVEHDTSGKSPLPEGGKYFGKYDLFSHYSM
KSGTCFGGGVFLRDVSCYFSVLEEGQPREKLEFTFKLYDKDCNQLLDSSEVDRIITQMMR
AADYLGWDATELRPVLKDMMTAIDVDGSGTVTLEEWVKGGMNNVPLLVLLGLKSSRPQMT
ERDGQHIWRMKHFNKPTYCSVCHSMLLGLGKQGLCCTFCKYTVHSHCANKNPEPCARTFV
RSKKEIGVAAHDWIKADKSTKCRVCHKKIKTLAGRRCVWCQEMRHDECIFLGLSSCDCGP
LRDHILPPWAIHAVPKSNTSTSAGTNPLVKYFKFKVSDNHLQPSCSIIHFYMTKYAASVL
ASSQLGILLQIVSIPNIHPLLVFVNPKSGGKQGLRVLRKFQYLLNPRQVYNLSNGGPAPG
LHFFRNLREFRILVCGGDGTVGWLLDAIDKENLQVHPPIAVLPLGTGNDLARCLRWGGAS
SPKKGYDGSDLREILKEVEASELVPMDRWSIQVIPDDPQEAGDPVPYEIINNYFSVGVDA
SIAHRFHSMREKYPQRFNSRRKNKLWYLEFATSETISASCKRLKECLTIECRGKFVDLSS
MSLEGIAVLNIPSMHGGSNLWGESKKPNSGPGVEHSEIITDPELLKTISQDMSDKLLEVV
GLEGAIEMGQIYTGLKSAGHRLAQTSQITIRTIKALPMQIDGEPWMQPPCTIHIRHKNQA
NMLMAAPTKSTGFFHHK
Download sequence
Identical sequences G3N5L2
69293.ENSGACP00000000585 ENSGACP00000000585 ENSGACP00000000585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]