SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000628 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000628
Domain Number 1 Region: 294-458,854-1030
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 9.77e-115
Family Mammalian PLC 0.00000764
Further Details:      
 
Domain Number 2 Region: 622-719,783-808
Classification Level Classification E-value
Superfamily SH2 domain 1.8e-28
Family SH2 domain 0.0000375
Further Details:      
 
Domain Number 3 Region: 1049-1167
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.65e-22
Family PLC-like (P variant) 0.0051
Further Details:      
 
Domain Number 4 Region: 507-618
Classification Level Classification E-value
Superfamily SH2 domain 1.33e-21
Family SH2 domain 0.00083
Further Details:      
 
Domain Number 5 Region: 10-113
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-16
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 6 Region: 752-795
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000349
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 7 Region: 127-290
Classification Level Classification E-value
Superfamily EF-hand 0.0000000347
Family Calmodulin-like 0.048
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000628
Domain Number - Region: 445-492
Classification Level Classification E-value
Superfamily PH domain-like 0.000631
Family Pleckstrin-homology domain (PH domain) 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000628   Gene: ENSGACG00000000483   Transcript: ENSGACT00000000628
Sequence length 1170
Comment pep:known_by_projection scaffold:BROADS1:scaffold_163:143736:156643:1 gene:ENSGACG00000000483 transcript:ENSGACT00000000628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAIKRDLEMGVVMTVFRQKAERLTVQVIMETRQVAWTRTADKTDGVLDLFEIREVRPGRN
SKDFERFKDGKDKHDENSCFTIFYGSLFVLNTLSLGADSVQEAQKWLTGLELLRQETLEA
PTPVLIESWLRKQMYSVNQTKTHSISMKELKVLLASINYKPPSSRSLKDKFQEVGGKKDR
LDFAQFHKLYNLIMFEQNESSFAKHTDVNGCFNTDKPEASAVLLHDFQRFLIYQQKESWA
SDLNQVRELMTTFIDDTMRKTNDPEFTVSEFLSFLFSKENSVWNEKFSEICNLDMNNPLS
HYWINSSHNTYLTGDQLRSESSTEAYVRCLRLGCRCVELDCWEGPGEPIIYHGWTRTTRI
KFEDVVKAINDHAFVTSEFPVILSIEEHCPVEQQRQMARIFRDVFGDKLLTEPVEEMAEQ
LPSPTQLRGKIILKHKKLSVEGGITRDLRKGQKQGDLEIWDPVDQRWNKHYCVISEDKLY
YAEEYEEESGKEGSISPSPGSQFQDLHLSEPWFHGRLKEGRVMAERLIHDYCVENGGIDG
TFLARPSDTYVKDFTLSFWRSGRVQHCRIRSGSEGPHTYFYLTPNLHFPSVYSLIQHYRE
NPLRCQDFELRLTGAVPQPDPHLQKGWFYSNLSRGQAEDYLLRIPRDGAFLIRQREGEPD
SFAITFRGDGKVKHCRVQKEGNMYLLGTTTEFESLVDLVEYFRKKPLYRKIKLRYPVTPE
LVDHFSTPQEKDCAFLYEVKTYVEPNEIEPILVCPQSTVRAVYSYQAKNPDEHSFSKGAL
IHNVSKQSNGWWKGDYGGRLQLFFPSNFVEEVSNNTKPDVKGQDMEDNPLGELCKGVVDI
SKCNIQNLRSGKNGKPNVLTLQDVEQDSLQFDLAADSLEELFEWYQVGWNITQRVQSQIR
QQEEVEKKAEVAMEMSDLVVYCQPLSKEKDRFAADRYTYKQIRSFVENKMPGKSRTREFL
CYNRKALSRVYPKGQRVESSNYDPYPLWALGCHMVALNFQTADKYTQLNSALFSQNGRTG
YVLQPELMRDDGYEPQQERKKVKMSCSCVRLQVIAARHLPKPGRSIASPFVEIELCGHDE
EKFKTMVYRDNGLNPVWKSPADSAVFTVHEPELTFLRFVVNEEDMFSDPNFLAQATFPVK
GIRSGYRSVPLKNGYSEDLELASLLVFINV
Download sequence
Identical sequences G3N5Q4
ENSGACP00000000628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]