SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000630 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000630
Domain Number 1 Region: 9-98
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.75e-21
Family Ubiquitin-related 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000630   Gene: ENSGACG00000000492   Transcript: ENSGACT00000000630
Sequence length 1103
Comment pep:known_by_projection scaffold:BROADS1:scaffold_101:157722:177579:1 gene:ENSGACG00000000492 transcript:ENSGACT00000000630 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQTLGRVAESSGMIEVTVKTLDSQSRSYKVRGELTVKQFKEHISSSVEIPADKQRLIYQG
RVLQDERPLSEYHVDEKVIHLVERAPPQATTSGAEGVDDSTRGPDGGSSISSSRASTSPQ
GAPHDRNSYVMLGTFNLPSNGSVDLRINLDHSVQSEPRMRLQLAGNLLRDAHALIYRLEA
ISNFNCKGESSDSRSHSQPEFPQSSSSTVRGTGASQLMDTRSPPTPLSTQAEESANSEPK
PISHSLVPTVPCGGGRTNQPNHPSPAELVEVLSEVRRVEERLRPFIERTHSILVAATSAD
YNNNTQEREQNQHLLNQVGDALRLLGNGLVVLGDLRCNLAISPPRPLYVARPMALLPPGL
PHMAVPDITYFCLQINLGTTVTMTSNGRPTAEGQHQPPHGAGLSDQPSLSNRTSHQQGPG
GPRVITHQAMEPVVMMQMNGDVSAGPPAQVESVASSASNMEGAASTQHPQPAGTRVVINR
PSFSPHIPQPVGPRGTTIRLRATVPAAGQQLEQAPSSLTRMISGLVGQLLMAGQPDVSSI
STSSSTVSPPIPSANTSGQTSTHTTNTPSTGQPTEGSPEGHLAQLLGSVLGGAAPSITVT
LPAFFQGLSDFTQVSSQKSVLPAERRAAAPVPPQSSGPSPTLAGGDSGGDSLSPELFTGI
VQGVLSTMMSSLGAQQGNGESIAQFIQRLSQTSNLFSQGSGDAVGFFGDLLSVVCQSFSM
VDMVLLLHGNAQPLSRIQPQLTDFFNEHYLQGREPSDANIEIAAEQLINGLEEYIAESFA
TVTVRDGVDIVQTNLSFLRQQFTQMASLILHPNDITFGPRLLLLCTQGLFECLALNLYCL
RGEQRCLTAVITQRLRRMSAEVNPSLVNWLTSMMSMRLHVILENNPVTEDHIQHYIIYTQ
PKSSSCSTNVNIVMGTNGSCDHPICQMEDSLSPAPATTAVEAPGERGASPGVKPALSGDR
SCPGWGPTGREEASPGVESWAAAVPPEWVPIIRNDMLSQRKMKGQPPLSDAYLHSMPAKR
RKMTQCEGPHLSLSDAVGRAARAAGAQPVTDPNCLQGELETPELQEAYTQQVKSDIRERV
RDNPNYNTQRFPNTHQAFSVEDS
Download sequence
Identical sequences G3N5Q6
ENSGACP00000000630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]