SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000632 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000632
Domain Number 1 Region: 5-93
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.99e-21
Family Ubiquitin-related 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000632   Gene: ENSGACG00000000492   Transcript: ENSGACT00000000632
Sequence length 1190
Comment pep:known_by_projection scaffold:BROADS1:scaffold_101:157737:177224:1 gene:ENSGACG00000000492 transcript:ENSGACT00000000632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RVAESSGMIEVTVKTLDSQSRSYKVRGELTVKQFKEHISSSVEIPADKQRLIYQGRVLQD
ERPLSEYHVDEKVIHLVERAPPQATTSGAEGVDDSTRGPDGGSSISSSRASTSPQGAPHD
RNSYVMLGTFNLPVNIMDQQQIQMSVQQMRTGVGEAGRNSRVSTSSGSNGSVDLRINLDH
SVQSEPRMRLQLAGNLLRDAHALIYRLEGESSDSRSHSQPEFPQSSSSTVRGTGASQLMD
TRSPPTPLSTQAEESANSEPKVDLFLSPPVLYVLSHPSPAELVEVLSEVRRVEERLRPFI
ERTHSILVAATSADYNNNTQEREQNQHLLNQVGDALRLLGNGLVVLGDLRCNLAISPPRP
LYVARPMALLPPGLPHMAVPINLGTTVTMTSNGRPTAEGQHQPPHGAGLSDQPSLSNRTS
HQQGPGGPRVITHQAMEPVVMMQMNGDGEAASGSQVPGLPNTAGTAQPSAALCSLFSGIP
SEFMQAIVHQMSHQAAAMAPAVSAGPPAQVESVASSASNMEGAASTQHPQPAGTRVVINR
PSFSPHIPQPVGPRGTTIRLRATVPAAGQQLEQGPPPAPSSLTRMISGLVGQLLMAGQPV
CEFYGASVQTVVFLVTPPPGDPMSTSSLASSQSSISTSSSTVSPPIPSANTSGQTSTHTT
NTPSTGQPTEGSPEGHLAQLLGSVLGGAAPSITVTLPAFFQGLSDFTQVSSQKMSAQPAE
RRAAAPVPPQSSGPSPTLAGGDSGGDSLSPELFTGIVQGVLSTMMSSLGAQQGNGESIAQ
FIQRLSQTSNLFSQGSGDAVGFFGDLLSVVCQSFSMVDMVLLLHGNAQPLSRIQPQLTDF
FNEHYLQGREPSDANIEIAAEQLINGLEEYIAESFATVTVRDGVDIVQTNLSFLRQQFTQ
MASLILHPNDITFGPRLLLLCTQGLFECLALNLYCLRGEQRCLTAVITQRLRRMSAEVNP
SLVNWLTSMMSMRLHVILENNPVTEDHIQHYIIYTQSEVEFDKKIPTPHPVQSEMEDSLS
PAPATTAVEAPGERGASPGVKPALSGDRSCPGWGPTGREEASPGVESWAAAVPPEWVPII
RNDMLSQRKMKGQPPLSDAYLHSMPAKRRKMTQCEGPHLSLSDAVGRAARAAGAQPVTDP
NCLQGELETPELQEAYTQQVKSDIRERVRDNPNYNTQRFPNTHQAFSVED
Download sequence
Identical sequences G3N5Q8
69293.ENSGACP00000000632 ENSGACP00000000632 ENSGACP00000000632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]