SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000639 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000639
Domain Number 1 Region: 17-88
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000752
Family PB1 domain 0.00033
Further Details:      
 
Domain Number 2 Region: 207-257
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000989
Family ZZ domain 0.02
Further Details:      
 
Domain Number 3 Region: 914-950
Classification Level Classification E-value
Superfamily UBA-like 0.00000037
Family UBA domain 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000639   Gene: ENSGACG00000000496   Transcript: ENSGACT00000000639
Sequence length 961
Comment pep:known_by_projection scaffold:BROADS1:scaffold_80:424630:442203:1 gene:ENSGACG00000000496 transcript:ENSGACT00000000639 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEPRLSTQWSVGSVLVIHWLSHTPILTFSLYEAHVKRSFGLCSLQLTYFDEENEEVSINS
QVDYEEALKSAVRQGNRLHMNVYETRGQPARGPTSKTSGTEPKKGFRPPQHCPALAQVVS
RKVQAAVPEQGMVMLKEMKGTKEEDKTPPAWFTSYMEKFKDQVVREAVEKICREFSGQCC
IHKPQVQQVPEVASSTLPGAPSPSTPPCSSCRGQTTGGGYQCSVCTSCTLCEPCSFSHDP
SHNLVRARTPLSIPEHGSPAPDHSRYRSPVIPAAQTRLSLLRFYRRGDRSFRKAEKQRLK
AEKRLLKAEVKEIRKQLRMERRGIQWSSSHRDGSSSPVLLQPRATQHNSPERPKRPCPLV
VPAMTAAFLDENLPDGTRLRPGTKFIKYWKMRNTGTICWSTDTKLKFMWGNLAVGSGDRW
REVSVPFLQPGQVGIVSVALCAPAVEGSYTSHWRLAHAGEQFGPRVWCSIMVDPLAPAPM
MADGILVSPCVTPQVESLNPRQRPGFFQAHDSKQLGKNPAAKDGKACTAREQPLMSVDQE
EYYIPSVDLLTAQDLLSFELLDINIVQELESVPNNTPADMTPCMSPVHQDGLLQDKGSPS
LALIQEETEVNNSIMDAPHGAGPAAEGGGVPAQEEGEDDMSGTQFVCETVIRSMTLEEAP
DHAPLRRTLPGPVREFNNPAFSSVDVKGEENRENIRMEKRPEKEGGEKREGTRSRSSSTS
SEDYIIILPDCFDTSRPLGESMYSSALSQPGDVPAKTPTDPETPSPTLPDTSPPEGGPGE
AQGMAVSGASSANDMLCTSQTLDDEPLTPEVVAPPQAIVTPRPCIKHYNQPLPSPLYEYC
TTVSGPEQTQTDDAESVSKLVSTVINFYTDFLKHPGLTGGLVKGALSVAASAYKALFTGQ
GPSQPPVEASTQGTMMAVLVEMGFGDRLLNQRLLKKYNYNLLDVVNELVQMTDNDWYSTR
Y
Download sequence
Identical sequences G3N5R5
69293.ENSGACP00000000639 ENSGACP00000000639 ENSGACP00000000639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]