SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000644 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000644
Domain Number 1 Region: 2-39
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000197
Family PHD domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000644   Gene: ENSGACG00000000501   Transcript: ENSGACT00000000644
Sequence length 283
Comment pep:known_by_projection scaffold:BROADS1:scaffold_139:122735:124272:-1 gene:ENSGACG00000000501 transcript:ENSGACT00000000644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CLQCESCLCWQHGTCMGLYEHNVPHNYTCYYCRHTAGWRRAQRFLSEPDLLISGHMFGLS
CVKENYSETNAATISHTNSLLAHTHALNQVLSGLQLKISLLDTPSHPDLQLWRLPWRREE
GLRAAGGPRGEPPVCYVSSEHCYQKPGASWEKAQAAVKQQQEEEIDLRVKKQTKLYTLFK
NPNDVPTDANVAAHTDRRQHARAQTCPAPEAECQLNLLEHVESLHHQISGRMDVIERELD
VLESWLDHSGELEPPDPLSRLPQLKQRIRRLLRDLCTVRHLSV
Download sequence
Identical sequences G3N5S0
ENSGACP00000000644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]