SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000735 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000735
Domain Number 1 Region: 285-347
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.87e-16
Family PHD domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000735   Gene: ENSGACG00000000567   Transcript: ENSGACT00000000735
Sequence length 481
Comment pep:known_by_projection scaffold:BROADS1:scaffold_90:6243:9728:-1 gene:ENSGACG00000000567 transcript:ENSGACT00000000735 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QMLGTLTAVPIKVPQVSSLHRLAGQAATMLPQVRPKTQIPDSLPQGPAHQLQPVSLQRAV
AVVSPRSQGPAAASPRSQGPAAASPRRQGPAAASPRSQGRTLPTANRRLQPEHQPNTQSD
GPFGGSRPPSDSLQQALAGPGVAYRNHRLSRLPPRNGSSASARPSSKVVDYFIFVCYQVI
IIQPQAPSSPEGPPGAPADPPSQEAPPAPTCPSQKKDEDPKKVAFMVALGLVTTEHLEEI
QTKRQERKRRSTANPAYSGLFEPERKRLASHYLNSSLFLSARDTEDFSWKKEDVEHDDLC
AVCKEDGELQPCHNCPRAFHPDCLHPPLKTPPRGPWYCPKCQKKVLNKENMSWPHNFVQS
YVTHKTVRQEEKRRLLRRSSELKKEFSHLEEEDEKLSDTLKQCMDLRERLLGQQRDTQAS
LKRLKALIRLIQRDQLIQVTMTTTATIAAASLLSQSWIKPTSAGPPSPSAAPLQQKSHAH
S
Download sequence
Identical sequences G3N611
ENSGACP00000000735 ENSGACP00000000735 69293.ENSGACP00000000735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]