SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000745 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000745
Domain Number 1 Region: 297-425
Classification Level Classification E-value
Superfamily PH domain-like 5.16e-27
Family Ran-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000745   Gene: ENSGACG00000000570   Transcript: ENSGACT00000000745
Sequence length 427
Comment pep:known_by_projection scaffold:BROADS1:scaffold_90:35704:39195:1 gene:ENSGACG00000000570 transcript:ENSGACT00000000745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIADKELTDRNWDQEEEGEEAGTFLVASEDVLKSRPIKKAKRRNTGEVEGSGSFKGF
KGFSLATAPSGGGIASTPTAFSGFGNGAGFAGLGGLANGNSIAPAFRGFSSPSATGPPAP
GLSFTGPASSDITAQQTNGSPQAAGSSKEYSRQLTALNCSVRDWITKHVNGNPLCDLNPI
FRDYERHLASIERQYGAGSSSADEDKKTTPPAAPPAAPPSSSSTATPFSFGKAPTDDPSK
GPGVTFNFGQKVDGCVLGALGSKATHPSFSFASGQTSVFASVSGTKAEEARRPDENGEEE
SEEPPKAEVKEVKEDDAFYSKKCKLFYKKDSEFKEKGVGTLHLKHTEDAKVQMIIRADTN
LGNILLNILLQASMPFSRVGKNNVMVVCVPNPAVDDKNPGCPVPLLIRVKTAEDADELHR
TLEEKKG
Download sequence
Identical sequences G3N621
ENSGACP00000000745 69293.ENSGACP00000000745 ENSGACP00000000745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]