SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000755 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000755
Domain Number 1 Region: 315-381
Classification Level Classification E-value
Superfamily F-box domain 9.29e-16
Family F-box domain 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000755
Domain Number - Region: 1-80
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00155
Family Ubiquitin-related 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000755   Gene: ENSGACG00000000581   Transcript: ENSGACT00000000755
Sequence length 480
Comment pep:known_by_projection scaffold:BROADS1:scaffold_90:49901:53754:-1 gene:ENSGACG00000000581 transcript:ENSGACT00000000755 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRVRINRHTSRVEVPGEAAGLKELTDIVRETILSSQGLSADSHFSLSLNGSTLLTDSG
QTLSSCGIVSGDLICVVLPESTAESDGSAAARTTGDSDNQNQQVQQVQQVQQAATTSNQV
REWIRRHSRLAPTVPGPERTGPPPPRWEPMLCSEAEDGRAPASLELLLHSAQTSSPSDAV
VVAGHLLMLETGFVPQAGELKASEMPAGWRSPGVYKLQYTHPLCEGSGALVVSVCMGAVL
VINVVAVATLKVNETVDAVRKLCVNPSSYVTDQQPGKGAAAIYRDLRKLSRVFKDQLAYP
LIAAARDAVALPVLFGLAALPPELVLRVLRLLDVRSVVRLSAVCRRFAVSTADSSLWRHL
YRRDFSDGDLSRSRDTDWKEVNHSLFVSSQRYLKRICEIFRYLILILLLITSSSTKGSIR
SAVSADRGIIGGDYDQNPGLPRVLLPRPRYDPVGPPGLDRRLPRGRPMGGRAADIRRGFI
Download sequence
Identical sequences G3N631
ENSGACP00000000755 69293.ENSGACP00000000755 ENSGACP00000000755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]