SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000769 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000769
Domain Number 1 Region: 509-621
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 3.53e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.0003
Further Details:      
 
Domain Number 2 Region: 12-176
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.23e-28
Family G proteins 0.00000294
Further Details:      
 
Domain Number 3 Region: 286-348,450-493
Classification Level Classification E-value
Superfamily PH domain-like 4.17e-16
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 
Domain Number 4 Region: 645-740
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000000264
Family Ankyrin repeat 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000769   Gene: ENSGACG00000000599   Transcript: ENSGACT00000000769
Sequence length 799
Comment pep:novel scaffold:BROADS1:scaffold_27:1245354:1252031:1 gene:ENSGACG00000000599 transcript:ENSGACT00000000769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSQEWTMSQTVQELHLGVLGGLCSGKSALVHRHLTGSYLQLENAEGRQYIKDVLVDGQSH
LLMIREETELPSAQLTTWLDAVILVFSLENEASFQEVYRIYHQLATHRPVSEIPFVVVGT
QDKISSSNPRVIDDARARQLCSDVRRCTYYETCATYGLNVNRVFTDAAQKIMTAKKQAAL
VASCKSLPNSPSHSGGSTPVSGVFPGQASNGGQSSDYSSSLPSTPVISHKEIGKTLRGEK
QDSATPGSVRSATRRRTSRFAGRRGSDSNRRSADCMGDLGSGRFIPIKQGILLKRSGHSL
NKEWKKKYVTLSNDGILSYHSSVNDYMLNAPGKEMDLLRVTVKVPGKRPPRAVPAYGLAV
GLNGRVKDAPGPEGVSPVPVSASNLLQVEEMEGLGGALFLRGNRVEGVSSSSSTKDLGSS
SPLTDRKKHRRKKSMNQKGDATIGQADDEDNFDFLIVSSTGQTWHFEAQSAEERDSWVQA
VESQILASLQLCESSKNKARRNSQSEAVVLQAIRNAKGNNFCVDCNAPNPTWASLNLGAL
ICIECSGIHRNLGTHLSRVRSLDLDDLPRELTLVLSAIGNHMVNSIWEARTLGSRKPAPD
ATREERELWIRAKYEQKLFVAALPPPSPGEGPDITLSGRLLLSVMEHNLPKMLLLLAHCT
KEDINAPLSLALSCRSLVALRLPGSALHAACQQADVVMTQLLVWYGCDVGLRDAQGRTAL
VLARGAGSQECVDILLQYGCPNEPASSFCVATTVGFAAAATPSFPVAMTPSLTVATTLKI
SHKSGGASLSYSTSRRAVS
Download sequence
Identical sequences G3N645
ENSGACP00000000769 ENSGACP00000000769 69293.ENSGACP00000000769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]