SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000776 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000776
Domain Number 1 Region: 55-183,354-540
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.34e-46
Family p120GAP domain-like 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000776
Domain Number - Region: 207-302
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.085
Family Ubiquitin-related 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000776   Gene: ENSGACG00000000602   Transcript: ENSGACT00000000776
Sequence length 573
Comment pep:known_by_projection scaffold:BROADS1:scaffold_365:19461:23808:-1 gene:ENSGACG00000000602 transcript:ENSGACT00000000776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLMTEMMDLSSDVGGPGLPLLDYRTYAERVFFPGQQVAPLSRQLDLPESRRPTVEQGLQQ
LNNLLNNRLFLTRFIHTLEAQQGFSQRDRGYVASLLTMALHDKLEYFTEVMKSLLQDLVQ
QYVVKNPKLMLRRTETVVEKMLTNWMSICLYSFLKEVAGEPLYMLYRAIKYQVDKGPVDT
VTGKAKRTLNDSHLLREDIDYCSMTLMVLVKNGVEVQPCPVKVLDTDTITQVKDKILDQV
YRGAPFSQRPAADNLDLEWRSGQAGHLTLSDDDVTAVIQGHWKRVNTLQHYKVPDGATVA
LIPRSQSSETPMLEGEEEEGLRLWHLVKSSEDPEIPKHRKSSMRERERAKAIPEIYLTRL
LSMKGTLQKFVDDVFVAILSTKRPPPIAVRFFFDFLDDMAEKHGIDDPETVHIWKTNSLP
LRFWVNILKNPQFVLDVQITDSIDAVLSVIAQTFIDSCTTSEHKVGRDSPVNKLLYAREI
PRYKQLVERYYSDIHSSASGCYQEMNSTLTELSGSFASEMNSLVALHELYKYINKYYDQI
IMSLEEDTSGQKMQLAYRLQQVAALVENKVTDL
Download sequence
Identical sequences G3N652
69293.ENSGACP00000000776 ENSGACP00000000776 ENSGACP00000000776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]