SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000786 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000786
Domain Number 1 Region: 9-318
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.4e-59
Family Protein kinases, catalytic subunit 0.00023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000786
Domain Number - Region: 307-359
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0017
Family Ubiquitin-related 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000786   Gene: ENSGACG00000000607   Transcript: ENSGACT00000000786
Sequence length 714
Comment pep:known_by_projection scaffold:BROADS1:scaffold_90:145923:155874:1 gene:ENSGACG00000000607 transcript:ENSGACT00000000786 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSTTNYLWLISDLLGQGATANVYRGRHKKTGDLYAVKVFNNLSFLRPLDVQMREFEVLK
KLNHKNIVKLFAVEEESNTRHKVLVMEYCPCGSLYTVLEESSNAYGLPEDEFLLVLHDVV
AGMNHLREYGIVHRDIKPGNIMRVIGEDGRSVYKLTDFGAARELEDDEQFVSLYGTEEYL
HPDMYERAVLRKDHQKKYGATVDLWSIGVTFYHAATGSLPFRPFEGPRRNKEVMYKIITE
KPSGTISGHQKCENGKIEWSTEMPVSCSLSKGLQSLLTPVLANILEADQEKCWGFDQFFA
ETNDILHRTVVYVFSLQQATLHHIYIHEYNTAALFQELLSRRTSIPLHNQELLYEGRRLV
LDPNRQAKMFPKSSRDNPIMLVSRESVATVGLIFEDPSPPKVQPRYDLDLDASYAKTFAG
DVGHLWKTSESLLVYQELVRKGVRVYVQVTSFETSFSSSHLQRISKVILTIKSFSSNYNI
ILHHQYQSHHQHQLTDFPSLSRFEALMQANVMSSEYDEICDMHKKVLRVSARLVGCLDSV
EKIKVLLDAITAIYQQFKKDKAERRLPYNEEQIHKFDKQKLVLHATKARSLFTEECAMKY
RLFISKSEEWLKSSLEVKTHRDSLRCYWLSDSFCLQLQEHLPQKVLPLVSSGMKPQAYLS
QNTLVEMTLGMKKLKEEMDEVSKELAENNHFLERLSLLQVWVPDAGRRTEGIRV
Download sequence
Identical sequences G3N662
ENSGACP00000000786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]