SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000801 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000801
Domain Number 1 Region: 56-181
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-48
Family Phosphotyrosine-binding domain (PTB) 0.0000811
Further Details:      
 
Domain Number 2 Region: 520-575
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000374
Family SH3-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000801   Gene: ENSGACG00000000619   Transcript: ENSGACT00000000801
Sequence length 576
Comment pep:known_by_projection scaffold:BROADS1:scaffold_90:181817:191787:1 gene:ENSGACG00000000619 transcript:ENSGACT00000000801 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNGHEGSGVFGSYGSQTNGRGSRSPEPPQNKAQSVAKALYEQRKSFTRTSINSLTDTSQY
HVEHLTTFVLDRKDGLVTVDDGVRRLRLLDAKGKVWTQEMLLQVEEKSVSLIDQETKKEL
ENFPVGSILLCQAVMNACSFDSILALVCRESGQSKPDLHLFQCDDIKANLIHVDVESAMT
DAKAGKVKRRPEALKMILKSDGVIPPPPASPAPAPPTPLSNQVDARSRAAAWSAWTNEQH
DYEKQRRTSLDEGPAEISALRVDRDVQILNHILDDIERFVNKLQKAAEAFGQLSKRKKVK
KGKKNGPGEGVLTLRSRPPAEDEFVDCLQKFKHAFNQLGKLADLIQNPSAEELLHFLFSP
LRMVIQASGSVDLARSVVVPLLTRDAIDFLHTTGTPEERHLWVALGDGWTKCRLEWPKHH
YFPPCALTFHDGWEPLPRDQDVTQHAEGLTDARIQRQEDPRIGLEVNSAVQNFPLADGSS
SCGSSRGMQIPDQDAAAAAFEQAVSRRTDGSFEADSRIQPKLFAKCKYDFVARNSSELSV
LRDEVLEVLDDRKQWWKVGNGAGASGYVPNNILEIS
Download sequence
Identical sequences G3N677
ENSGACP00000000801

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]