SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000803 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000803
Domain Number 1 Region: 50-175
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-48
Family Phosphotyrosine-binding domain (PTB) 0.0000811
Further Details:      
 
Domain Number 2 Region: 481-539
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000187
Family SH3-domain 0.00012
Further Details:      
 
Domain Number 3 Region: 709-767
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000673
Family Pointed domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000803   Gene: ENSGACG00000000619   Transcript: ENSGACT00000000803
Sequence length 805
Comment pep:known_by_projection scaffold:BROADS1:scaffold_90:182857:196703:1 gene:ENSGACG00000000619 transcript:ENSGACT00000000803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NNKYNHIASFLNGRGSRSPEPPQNKAQSVAKALYEQRKSFTRTSINSLTDTSQYHVEHLT
TFVLDRKDGLVTVDDGVRRLRLLDAKGKVWTQEMLLQVEEKSVSLIDQETKKELENFPVG
SILLCQAVMNACSFDSILALVCRESGQSKPDLHLFQCDDIKANLIHVDVESAMTDAKAGK
VKRRPEALKMILKSDGVIPPPPASPAPAPPTPLSNQVDARSRAAAWSAWTNEQHDYEKQR
RTSLDEGPAEISALRVDRDVQILNHILDDIERFVNKLQKAAEAFGQLSKRKKVKKGKKNG
PGEGVLTLRSRPPAEDEFVDCLQKFKHAFNQLGKLADLIQNPSAEELLHFLFSPLRMVIQ
ASGSVDLARSVVVPLLTRDAIDFLHTTGTPEERHLWVALGDGWTKCRLEWPKHHYFPPCA
LTFHDGWEPLPRDQDVTQHAEGLTDARIQRQEDPRIGLESAVQNFPLADGSSFEADSRIQ
PKLFAKCKYDFVARNSSELSVLRDEVLEVLDDRKQWWKVGNGAGASGYVPNNILEISGGV
EGRGEPVYSHTIQIKPFKTYFCCCSITNPLKYNSCHQKPQEKLLTASIMFVSCVASTTAT
SFKQVAFVVAKQTTRTDPVPDKPLVTPNSTTSSESGGVAMRDHRGQKDQKDQKDQRDQRP
PPVTRRKSNMEEVQDELMHRLTLGRSAQKKFPVSTRGGLPSNSITYDSSPEDVKAWLEAK
GFSPVTITSLGVLTGAQLFSLNKEELRTVCPDDGARVFSQVTVQKAALERGSSSELQEIM
RRRQEKLASITCDSGVESLDECSAR
Download sequence
Identical sequences G3N679
69293.ENSGACP00000000803 ENSGACP00000000803 ENSGACP00000000803

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]