SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000813 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000813
Domain Number 1 Region: 54-290
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.53e-58
Family DBL homology domain (DH-domain) 0.0000176
Further Details:      
 
Domain Number 2 Region: 289-414
Classification Level Classification E-value
Superfamily PH domain-like 2.1e-31
Family Pleckstrin-homology domain (PH domain) 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000813   Gene: ENSGACG00000000625   Transcript: ENSGACT00000000813
Sequence length 882
Comment pep:known_by_projection scaffold:BROADS1:scaffold_405:10131:17543:-1 gene:ENSGACG00000000625 transcript:ENSGACT00000000813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLKGLKFLSQSTDSLHKGGKVNASTESLTDEGTEMMDSQLMGEFECDTKDLEADSWSGTM
EKKFLKLLKKDEIKKQDVIYELYQTEFHHVRTLKIMSEVYYKGLQKELQLDPQTLDKIFP
VLDDMLETHTHFLTLLLERKKASSTEGQNNNYLIFSIGDVLLNQFSGSSADRMKRVYGKF
CSRHSEAVNLYKDLHAKDKRFQAFIKRTMSSSIVRRLSIPECILLVTQRITKYPVLIQRM
LQHTKDSDEDHGCVCEALRCVKEMITAVDSKVNEQEKKQKLREVYSRTDSKSIMRMKSGQ
MFAKEDLIRGRKLLHDGALQLKNSAGRLKDVQAMLLSDVLIFLQEKDQKYVFASLDQRST
VISLQSLIVREVANEERGLFLITAGIEKPEMVEVLASSKEERNTWRAIIQDAMHCMEKDE
DEGVPSETEEDRRQQESRAKEIRELLRRKDEQIISLLEEKVHIFRDLGDSSPAPDDPSPP
VRERMLFMATPDDVTKGEPIMMDALREVETLHGLVNSGCSVPVGLTGGSVGPVCLPRRAE
TFGGFDSHQMNSSKNGDKEEGDESLDLRRTESDSVLKKGATASLQMLLKRNHEQVQHSVT
HLHGLLISLQAVVVQQDSYIEDQRQTLSERLTANSSRHSSSSSLSSSSSSRPSSLIEQEK
HRSLERQRQEAATLQKQQAAHQEEKRRREKAWELKDRCLAEREERLRADEDQTQMRHREV
TEEWEALRRRKEEYQVELERLREAQRRLDRDKEALKRDTERLEAMNTRLGFLQVPPPGTR
LTEVTLPMITLLPDEVAAPFRVSLLGSGSLDLEPKEAAEQPKVIGSKRMKKNFNPFSSSS
SSKTQGAEKEAQLPNRLLQLTKPKEKKDKRKTKGKAEQTQTG
Download sequence
Identical sequences G3N688
69293.ENSGACP00000000813 ENSGACP00000000813 ENSGACP00000000813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]