SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000841 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000841
Domain Number 1 Region: 334-402
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 4.11e-25
Family PHD domain 0.00012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000000841
Domain Number - Region: 146-329
Classification Level Classification E-value
Superfamily Variant surface glycoprotein (N-terminal domain) 0.0915
Family Variant surface glycoprotein (N-terminal domain) 0.04
Further Details:      
 
Domain Number - Region: 18-112
Classification Level Classification E-value
Superfamily 14-3-3 protein 0.0942
Family 14-3-3 protein 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000841   Gene: ENSGACG00000000654   Transcript: ENSGACT00000000841
Sequence length 409
Comment pep:known_by_projection scaffold:BROADS1:scaffold_90:310719:314525:1 gene:ENSGACG00000000654 transcript:ENSGACT00000000841 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNATDQLEQKVMEFFVNAKKNKPEWREE
QMEVIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQELAKFKMELEADNAGITEVLE
RRSLEMDSPSQPVNNHHIHSHSATETTEHVPEKKFKSEALLSTLTSDASKENTPGCRTNS
TSSSTNNVYIGVASSQPLASYNLSSLPAGTGSGAGAITMAAAQAVQATAQMKEGRRTSSL
KASYEAIKNNDFQLAREFTLSRENTGYSSSALASTLTQTLTPPTASDSRGRKSKSSIKSS
NHQSSSSSSSSSLSSCSSSSALAQELSQQASALPEAEANSQVDWTYDPNEPRYCICNQVS
YGEMVGCDNTDCPIEWFHYGCVGLTEAPKGKWFCPQCTVAMKRRGSRHK
Download sequence
Identical sequences G3N6B6
ENSGACP00000000841 ENSGACP00000000841 69293.ENSGACP00000000841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]