SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000904 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000904
Domain Number 1 Region: 79-183
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 3.66e-21
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000795
Further Details:      
 
Domain Number 2 Region: 178-292
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 1.07e-19
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000603
Further Details:      
 
Domain Number 3 Region: 26-77
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000181
Family TS-N domain 0.00066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000904   Gene: ENSGACG00000000697   Transcript: ENSGACT00000000904
Sequence length 299
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:1842329:1844827:-1 gene:ENSGACG00000000697 transcript:ENSGACT00000000904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLSSAEFKDVVNVFIQSNDERLCKAEKALLMKLRKTTGYTFINCKKALERFDNDITQAET
WLHAEAQKEGWSRASKLEGRKAKEGLVGLFIQDTAAVMVEVNCETDFVARNDKFQQLVKD
VAFATLAHHRNKTQSKTGYVKSILAGDELNKLCVEEGASLSDRVALTIGRLGENLSVRRA
VTVGVPAEWHIGSYVHGGVHGQTEVAMGRYAALVVFQGGEKEQWDVLGRKLGQHIVGEAP
VSLGNMDDLPCGESETRLLPQTFLGDPSRTVAEFLRGQQARVLDFIRFQCGESVDDQVK
Download sequence
Identical sequences G3N6H9
ENSGACP00000000904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]