SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000926 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000926
Domain Number 1 Region: 56-234
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.4e-43
Family DBL homology domain (DH-domain) 0.0000278
Further Details:      
 
Domain Number 2 Region: 234-313
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-17
Family Pleckstrin-homology domain (PH domain) 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000926   Gene: ENSGACG00000000714   Transcript: ENSGACT00000000926
Sequence length 340
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:1958925:1976910:-1 gene:ENSGACG00000000714 transcript:ENSGACT00000000926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVWTDGVSSPTTPPTQTPCQRHLSDLPQDTDTQSSSQRSSISTFQGKDVCSASDDSGSQW
SGAVDSEEERNIALEKSIYVLTELIETERLYVEDLGLIVQGTMVNQGVPEDLKGKDRIVF
GNIQQIYDWHKNYFLGELENRVADPDSLAQLFIKHERRLHMYVVYCQNKPKSEHVVSEFI
DTYFEDLRQLLGHRLQLNDLLIKPVQRIMKYQLLLKDFLKYYSKAGKDVEELQGKITAQG
KLLQQDTFCVSEQETGSRAKERRVFLFEQLVIFSEPIDKKKGFSLPAYTFKNSIKQGSCV
LQEIQQAWFDDVTDLSVSSKNPRIQQFLLLLSNVTSRPAD
Download sequence
Identical sequences G3N6K1
69293.ENSGACP00000000926 ENSGACP00000000926 ENSGACP00000000926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]