SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000969 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000969
Domain Number 1 Region: 235-619
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.26e-150
Family Myotubularin-like phosphatases 0.0000000000398
Further Details:      
 
Domain Number 2 Region: 112-232
Classification Level Classification E-value
Superfamily PH domain-like 1.13e-34
Family GRAM domain 0.0000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000969   Gene: ENSGACG00000000751   Transcript: ENSGACT00000000969
Sequence length 677
Comment pep:known_by_projection scaffold:BROADS1:scaffold_47:272139:283390:-1 gene:ENSGACG00000000751 transcript:ENSGACT00000000969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKQAGAAGAADGALPNRKPRAPPTCAPATGDTLDSPTGSHVEWCKQLIAATISSQISGS
VPSDIARDNKVQDSQEEVLCYHGDIYSELPSSASNLPALRYGAPVTMFQNQVPLLPGETV
QTTVKDVMYICPFSGLVNGTLTITDYKLYFTSVERECPFVLDVNLGVISRLETISVPNQG
ENTKGLELVCKDMRSPRFAYKTEESHPDVVELLSKHAFPLSHSLPLFAFLYKEQFPVDGW
KVYEPTAEYRRLGLPNESWAFSKMNSNYELCDTYPSILVIPTHIADDDVRRVAVFRARHR
IPVLSWIHPETQATIVRCSQPLVGPSDRRCKEDERFLQIIMDANAQSHKLTIFDARQSSV
AVTNKAKDGGYESESVYPNVELNFLEIPNIHVMRESLRKMKDVVYPTIDEAHWHSAIDQT
HWLEYIRLLLAGAAKIADKLESAKTSVVVHCSDGWDRTAQLTSLAMLMLDSHYRTLRGFQ
VLVEKEWVSFGHKFAARVGHGDENHANSERSPLFVQFIDCVWQMTRQFPAAFEFNELFLI
TVLDHLYSCLFGTFLYSSEQERAAKEVQTSTVSLWSYINSQPEDFTNPFYVDYEHHVLCP
LVSSRHLELWTGYYARWNPRMRPQVPVHQTLKELLFLRAELQRRVEELKRDATSRSSSSF
SEHSPSHAAGTPLHSAV
Download sequence
Identical sequences G3N6P4
ENSGACP00000000969 69293.ENSGACP00000000969 ENSGACP00000000969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]