SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000973 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000973
Domain Number 1 Region: 158-539
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 4.63e-153
Family Myotubularin-like phosphatases 0.0000000000401
Further Details:      
 
Domain Number 2 Region: 34-153
Classification Level Classification E-value
Superfamily PH domain-like 3.14e-39
Family GRAM domain 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000973   Gene: ENSGACG00000000753   Transcript: ENSGACT00000000973
Sequence length 600
Comment pep:known_by_projection scaffold:BROADS1:scaffold_47:288717:296739:-1 gene:ENSGACG00000000753 transcript:ENSGACT00000000973 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPVSVYSPTPMADRFSSQTSRESLKMELLADVSLLPGEERIIDKDIIYVCPFNRAVKG
KVLITNYRLYFKSSEADVVMALDVPLGAICRVEKMGGASSRGENSYGLEITCKDMRNLRF
ALKQEGHSRRDIFELLFKHAFPLSHGLPLFAYMSQEKYGENGWNIYKPMDEFRRQGLPNS
KWRVTFINNNYEVCDTYPTILAVPVKSKDEDLRRVAAFRSRGRIPVLSWIHRENQAVIAR
CSQPLVGMSGKRNKDDERYLDMIREANNTEKLTIYDARPSVNAVANKATGGGYEGDEYQN
AELVFLDIQNIHVMRESLKKLKDIVYPNVEESHWLSSLESTHWLEHVKLVLSGAIQVADK
VSSGNSVVVHCSDGWDRTAQLTSLAMLMLDSHYRTLRGFQVLIEKEWISFGHKFASRIGH
GDKNHADQDRSPIFVQFIDCVWQMTKQFPTAFEFNERLLLTILDHLYSCCFGTFLYNCES
ARDQHEVRSKTVSLWSLVNSRMEIYLNPFYTPESGRVLYPVASMRHLELWVTYYIRWNPR
IRQQQQVDLVMIXMELLALRDEYLKKLEELQQSSSSRLANTPNTTSSTPPQPYTELHTPL
Download sequence
Identical sequences G3N6P8
ENSGACP00000000973 69293.ENSGACP00000000973 ENSGACP00000000973

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]