SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000990 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000990
Domain Number 1 Region: 6-228
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-44
Family DBL homology domain (DH-domain) 0.00087
Further Details:      
 
Domain Number 2 Region: 383-434,464-567
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-25
Family Pleckstrin-homology domain (PH domain) 0.00018
Further Details:      
 
Domain Number 3 Region: 217-333
Classification Level Classification E-value
Superfamily PH domain-like 3.34e-22
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000990   Gene: ENSGACG00000000766   Transcript: ENSGACT00000000990
Sequence length 569
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:2107516:2118654:1 gene:ENSGACG00000000766 transcript:ENSGACT00000000990 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDSIYDRQVSSDKPDGRSRAYYIAKELVDTERLHVKGLKLLQEDFREAVGAAIGEEGEPV
LDEERLREILNELPDVYTLHRRILSELENRLRHWEESQRIADIYLSRKAQFLVFTTYIGH
YDRSMSLLEDSCRASPAFAAIVHQFEQQSPAGGKVSLKHQLLQVIVRVAQYRMLLTDYLN
NLSPDSKEYKDTQAAVAVVSDIADQTNDSLKHGENLLRLVNIEYSVRGLRDLLQPGRVFV
KEGTMMKVSRKSRQPRHLFLMNDVLLYTYPQQDGKYRLKNTLPLTGLTVSKPIVENVQNA
LKIEGTDISITLSASSFIEREDWFYTLSRTVTEHARGSVAFNSCLGEARDRLRLILGEKA
PTLVPVSQVMMCMNCTSDFSLTLRRHHCHGCGRIVCRSCSRNRYPLKYMKDRMAKVCDRC
YSELKKRGGEKQLEYIQLADFTTTQFIRNEITCYKKGSRTTKESVTVSEEGSISGTLQRS
KTSKRNWKRLWFLLRDKVLYTYRVQEEKVASESLPLLGFTVKLPDQLGTEEEANVFQLYH
KNTLYYSFKAKDNYTAQRWVNAMEEATVL
Download sequence
Identical sequences G3N6R5
ENSGACP00000000990 ENSGACP00000000990 69293.ENSGACP00000000990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]