SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001008 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001008
Domain Number 1 Region: 357-658
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.36e-93
Family Protein kinases, catalytic subunit 0.000000000474
Further Details:      
 
Domain Number 2 Region: 216-284
Classification Level Classification E-value
Superfamily Cysteine-rich domain 1.64e-22
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 5-119
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.27e-22
Family PLC-like (P variant) 0.00000646
Further Details:      
 
Domain Number 4 Region: 141-210
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001008   Gene: ENSGACG00000000771   Transcript: ENSGACT00000001008
Sequence length 686
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:2122858:2134135:1 gene:ENSGACG00000000771 transcript:ENSGACT00000001008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPFLRIAFNSYDLGVMSPLVDPPFCAIKMKEALTTERGKTLVQRKPTMYPAWKASFDAH
IYEGRVLEVLLMKTAEEPLAEVTVGVSVLAERCKKANGRAEFWVDLHPSGKVMMAVQYLL
EGVDTESKQATKEVEEGAPNLNRRRGAIKQAKIHVIKNHEFIATFFRQPTFCSVCREFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTVFQKERFKIDMPHRFKTHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCAMNVHHKCQDKVANLCGINQKLLAEALTQVSQKSST
RRSDPNLPDMPDIGIYDEVNKIARLEIADASPYGKLWEGANSRPPSHITHLTRINVDHFV
FHKVLGKGSFGKVLLAELKGRGEYFAVKALKKDVVLMDDDVECTMVEKRVLALAWENPFL
THLYSTFHTKEHLFFVMEYLNGGDLMFHIQEKGRFELNRTTFYSAEIICGLQFLHTKGII
YRDLKLDNVMLDHEGHIKIADFGMCKENVFGENRATTFCGTPDYIAPEILLGQKYSFSVD
WWSFGVLLYEMLIGQSPFHGDDEDELFESIRMDTPHYPRWINKEAEDLLERLFERDPTRR
LGIVGNIRSHPLFNNINWQALERREIEPPFKPKVKAPNDCSNFDREFLSEKPRLSHSDKN
FIDSMDQAAFDGFSFINPKMERLLEK
Download sequence
Identical sequences G3N6T3
69293.ENSGACP00000001008 ENSGACP00000001008 ENSGACP00000001008

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]