SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001037 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001037
Domain Number 1 Region: 1009-1126
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-25
Family PDZ domain 0.00055
Further Details:      
 
Domain Number 2 Region: 389-491
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-16
Family PDZ domain 0.00039
Further Details:      
 
Domain Number 3 Region: 567-669
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-16
Family PDZ domain 0.056
Further Details:      
 
Domain Number 4 Region: 119-181
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.13e-16
Family Nucleotide and nucleoside kinases 0.0031
Further Details:      
 
Domain Number 5 Region: 824-939
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000000946
Family PDZ domain 0.0064
Further Details:      
 
Domain Number 6 Region: 284-318
Classification Level Classification E-value
Superfamily WW domain 0.0000000000312
Family WW domain 0.0013
Further Details:      
 
Domain Number 7 Region: 20-96
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000434
Family PDZ domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001037   Gene: ENSGACG00000000805   Transcript: ENSGACT00000001037
Sequence length 1149
Comment pep:known_by_projection scaffold:BROADS1:scaffold_141:123491:137748:1 gene:ENSGACG00000000805 transcript:ENSGACT00000001037 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKATVKKLHWRSKVQESFVPLGGGSGELGLAIGGGADYGEFPFVTVAHGGGANVGDIIL
EIGGTPVLGMTLGDVRGVLNSCPHPIRIKTVSPGSSLCKDLRLYLSKCFTPGSMDSQLQQ
LIRENLYLRAVPCTTRQPRDGEISGVDYNFVSIEEFFSLEESGALLESGKFKGNYYGTPR
PVHIGLESPPITYQEHRNLLRNFRTRSKSLSNLEKAVEEGDNSEEDGGPSGQSTLITRAI
RSMTRAVLINNWVRSSICLSQQVWPESRPPSSLSANRGSRQWGGPLPENWELAFSESGEP
YYINHRSKTTSWLDPRTQSKETTPFTERSIKTNITEWTFSHINTGKRITYFYTSLPGRSV
LTCPLNHLSSHRPSPGHSVLTCPLTHLVSISVPEFTEQPGLLKGYSIHTRLAKGPRGFGF
NIVGGSRPKEFLQVYSVTPGGPPALNTADILVYINESSVLGSSHKEVVEMLKAVPMGQSV
DVVLRRGYPMLYNPDGCPKQSPETVRESFPPPPMLTPSQTPLSQRRPSTKVPSRTCPPPP
RLLALQCPRTYPSPRPENALELPLPPLEAAPPGELVPVALARGEGGGLGFSVTAGGGRGG
QLAVVRRVWDRRRCPSLQTGDTIVKVNGADVQSLSVCQVQRLLQEHTKQGEVVLLVIRGG
SVLSPVVTPNLYKPLPSPNSLATPTSSDTPTSPDLALPNTGALMGGISPLSRSGLVLESP
GEVPVVGTPQGEFSLSSWSSFFLSLSVFSISLTTPCHLVSIIPTSPGPPLSISLTAASFS
PEAPDAPASALIQSTSFLDSVPVTLTLEPRDLLGVEEGAGGPLPTRTGAPRGALGAIAKE
GRVGATRMVEVDLRRRAGEGFGFVIASQEASDVTGGVTPSLMSHRFVTVRRGSPAARSGQ
IQPGDQLEAVEGRGVGGLQHRDLAQILRRAGNTLRLSITPTRRMGSHTHTYTALYQHPLS
SDSSSLLRGADLDIAGRLVKGSRGRSRVSSSISTDSSSSSTTILKCASTNTSIHYSSLTS
SLTSISSTCIEESRFYNVDLERGPTGFGFSLRGGSEYNMGLYVLGLMEGGPAQRSNKIQV
SDQLVEINRDSTSGMTHSQAVEQIRRGGQRIHLVLKKGNGYVPDYVELSSLSLCMTNSKQ
GEPCFYVIG
Download sequence
Identical sequences G3N6W2
69293.ENSGACP00000001037 ENSGACP00000001037 ENSGACP00000001037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]