SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001093 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001093
Domain Number 1 Region: 10-87
Classification Level Classification E-value
Superfamily GIY-YIG endonuclease 0.00000445
Family GIY-YIG endonuclease 0.011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001093
Domain Number - Region: 163-231
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000604
Family PHD domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001093   Gene: ENSGACG00000000846   Transcript: ENSGACT00000001093
Sequence length 265
Comment pep:known_by_projection scaffold:BROADS1:scaffold_47:884465:887835:1 gene:ENSGACG00000000846 transcript:ENSGACT00000001093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAMVVEIDNFFGVYMLYCTNLKFKGRIYIGFTVNPERRIGQHNAGRHRGGAKRTSGRGPW
EMVLIIHGFASDIAALRFEWAWQHPHSSRRLSLVSRRSRKESSLQFHWRVVSNMLRVAPW
NRLPLTARWLKQEYRMDFEPGLQPPLHIPIAYGSVRAKKKLPSAGQEAEEEETSRCFLCK
ELVKVSEKLSCFHPSCGMSGHVLCLAKHFLKLEPSHLLPVEGECPACRRSLLWGSLIRNK
HCCFGDLEEITPSASQSHWADELQK
Download sequence
Identical sequences G3N718
69293.ENSGACP00000001093 ENSGACP00000001093 ENSGACP00000001093

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]