SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001097 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001097
Domain Number 1 Region: 178-260
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.48e-25
Family PHD domain 0.000038
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001097
Domain Number - Region: 15-83
Classification Level Classification E-value
Superfamily NAP-like 0.0107
Family NAP-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001097   Gene: ENSGACG00000000852   Transcript: ENSGACT00000001097
Sequence length 281
Comment pep:known_by_projection scaffold:BROADS1:scaffold_47:903568:905682:1 gene:ENSGACG00000000852 transcript:ENSGACT00000001097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGHHYPNADKSQQLVNYVEDYLECVESLPLDIQRNVSLLREIDAKYQEVLKEVDEVFEK
YKSEQDAAQRKRLQIQLQRALIISQELGDEKIHVVTQMTELVENRSRQMDSHSICLQEPS
EAERLTTERRTSVQDSSAPERTSARRRDASATARAATSSHRSGNGSVVDDPMEELPIPPP
REKKSKSAKKKKRKAKQERDASPVDFAIDPNEPTYCLCEQVSYGEMIGCDNDQCPIEWFH
FSCVGLTYKPKGKWYCPKCRGDNEKTMDKSLDKNRKDRRSR
Download sequence
Identical sequences G3N722
ENSGACP00000001097 ENSGACP00000001097 69293.ENSGACP00000001097

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]