SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001133 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001133
Domain Number 1 Region: 314-505,783-929
Classification Level Classification E-value
Superfamily Cysteine proteinases 9.03e-113
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.000000505
Further Details:      
 
Domain Number 2 Region: 25-140
Classification Level Classification E-value
Superfamily DUSP-like 6.02e-40
Family DUSP, domain in ubiquitin-specific proteases 0.00000306
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000001133
Domain Number - Region: 167-238
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00093
Family Ubiquitin-related 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001133   Gene: ENSGACG00000000872   Transcript: ENSGACT00000001133
Sequence length 958
Comment pep:known_by_projection scaffold:BROADS1:scaffold_27:2520261:2530510:1 gene:ENSGACG00000000872 transcript:ENSGACT00000001133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAEGGGPEPGGAADTDSEPVAAQMPTPSTEKQKQTIGSLLKTTLRKGDDWYLIDSRWFK
QWKKYVGFDSWDMYNVGEHSLYPGPIDNSGLFSDQETQALKEHLIDELDYVLVPTDAWKK
LVSWYGCLEGQKPIVRKVVEHGMFVKHCKVEVYLLELNLCENDNMDNVVTRHFSKADTID
TIEKEMRTLFNIPSEKETRLWNKYMSNTYEQLNKPDSTVQDAGLFQGQVLVIERKNEDGT
WPRQASHPKSSTTPSRNFTTSPKLSSNSTASISSTVTNGDSSCSPSYTLNNSTSSGNRLG
GYNSYSSSYNYRESQSQPGLCGLSNLGNTCFMNSALQCLSNASPLTEYFLNDQYEAEINR
ENPLGMRGEIAEAYADLVKQMWLSRSSYVAPRTFKTQVGRFAPQFSGYQQQDSQELLAFL
LDGLHEDLNRVKKKPYLALRDAEGRADEIVAKEAWTNHRLRNDSIIVDIFHGLFKSTLVC
PECSMVSVTFDPFCYLTLPLPMKKDRTMEVFLVRSDPQSRPTQYRVVVPKLGTVTDLCTA
LSKLCGFPQENMVVADVYNHRFHKVYRRDDGLNQIMEKDDIFVYEVQEENSERMNLPVYF
RERHSKHAGSSSSTMLFGQPLLVTVPRLNLTADILYDKILERIGRYVKQSQNPNSQSMAT
ASASVCSAEEEAMDHQVSPEPENGQSEEDEEETSDLEAGSKGAVSKQRSSPAKLFSFSIV
NSYGTANISPLPCDGNLLKLNPHSTVAIDWDAASKKLCYDEQEAEAYEKHESMLQAQKKK
ATVALRECTELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPRILVVHLKRFSYNRC
WRDKLDTVVDFPIRDLNMSEFVCDPKAGPYVYDLVAVSNHYGGMGGGHYTAYGKNKVDGK
WYYFDDSSVSSASEDQIVTKAAYVLFYQRRDEEAPSKPQPSASVGGAPEAADDHMDTN
Download sequence
Identical sequences G3N757
ENSGACP00000001133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]